SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383763342|ref|YP_005442324.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383763342|ref|YP_005442324.1|
Domain Number 1 Region: 2-229
Classification Level Classification E-value
Superfamily Tetrapyrrole methylase 2.75e-45
Family Tetrapyrrole methylase 0.0048
Further Details:      
 
Domain Number 2 Region: 262-373
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 0.0000000000000945
Family Siroheme synthase N-terminal domain-like 0.0025
Further Details:      
 
Domain Number 3 Region: 370-410
Classification Level Classification E-value
Superfamily Siroheme synthase middle domains-like 0.0000497
Family Siroheme synthase middle domains-like 0.0069
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383763342|ref|YP_005442324.1|
Sequence length 414
Comment putative precorrin-3B C(17)-methyltransferase/precorrin-2 dehydrogenase [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MAAQHHLRAAEVVIGYKFYVELIRPLLTDHQEVVGSPMGEEIERARQAIALAQQGRRVAL
ISSGDVGIYAMAAPVFELLHGQGWQGDDPRVFVTPGVSALQAVAGRVGAAIGHDFCAISL
SDLLTPWPIIERRIAAAAWGDFVIAFYNPRSRERTWQLARAVEILRRFRATSTPVAVARN
ITRHDEQVTVTTLQALDIEAVDMFSLVLVGNSQSFIVAGHIVTPRGYATARLHEAAQGES
AKQDRAPDAPRSGVRALYPITLTRFTEAAIVVCGGGKVGERKVRGLLDAAAEEGISPRIR
LISPTATETLQQWAAEGRIDWEARPYAAGDLFGARLVFAATSEREVNAAIAQEAAAVGAF
CNVADAPEEGDFHVPAVLRTEEALIAVSTGGADPRRAVSYRDRIRSLLSQAGSY
Download sequence
Identical sequences I0I589
gi|383763342|ref|YP_005442324.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]