SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|383764262|ref|YP_005443244.1| from Caldilinea aerophila DSM 14535 = NBRC 104270

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|383764262|ref|YP_005443244.1|
Domain Number 1 Region: 5-120
Classification Level Classification E-value
Superfamily AF1862-like 6.15e-33
Family Cas Cmr5-like 0.00078
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|383764262|ref|YP_005443244.1|
Sequence length 124
Comment hypothetical protein CLDAP_33070 [Caldilinea aerophila DSM 14535 = NBRC 104270]
Sequence
MSRQRSLEQERAKAAWERVAAVKGQSYAGKYGQLARSAPADIQANGLGQTLAFWKAKGEN
HHCALLEHVSEWVKGQIGFPDGDLLQWVVTTADTDGYRRATTEAIAFLVWLKRFAEAELP
KEGD
Download sequence
Identical sequences I0I7V9
WP_014434573.1.81527 gi|383764262|ref|YP_005443244.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]