SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51891783|ref|YP_074474.1| from Symbiobacterium thermophilum IAM 14863

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51891783|ref|YP_074474.1|
Domain Number 1 Region: 37-300
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 6.28e-75
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) gi|51891783|ref|YP_074474.1|
Sequence length 305
Comment proline dehydrogenase [Symbiobacterium thermophilum IAM 14863]
Sequence
MSSLARKAILSLAGNRFVTRVMTRHGLKIGAGRFVAGVTLQDAVAVTRRLNDEGLAVTLD
LLGEGVTDRDGARAMAEGCAGILEAIGREKLDANLSVKLTQLGLAVDPEAAMENMVYLQD
IARQAGIFIRIDMESSDVTDVTLDIVRRLYARERNVGTVIQAYLYRSPKDLEELARLGMN
VRLVKGAYLEPPSVAYPKKADVDAAFRRLIAQHLSAGCYTAVATHDDAIIAFTESFVKEK
GIPRDQFEFQMLYGIRPERQRELARAGYRTRVYVPFGSDWYPYFVRRLAERPANVWFVLA
NLMKP
Download sequence
Identical sequences Q67RR3
gi|51891783|ref|YP_074474.1| 292459.STH645

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]