SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for gi|51892113|ref|YP_074804.1| from Symbiobacterium thermophilum IAM 14863

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  gi|51892113|ref|YP_074804.1|
Domain Number 1 Region: 265-428
Classification Level Classification E-value
Superfamily HlyD-like secretion proteins 0.00000929
Family HlyD-like secretion proteins 0.011
Further Details:      
 
Weak hits

Sequence:  gi|51892113|ref|YP_074804.1|
Domain Number - Region: 59-107
Classification Level Classification E-value
Superfamily Single hybrid motif 0.00222
Family Biotinyl/lipoyl-carrier proteins and domains 0.0074
Further Details:      
 
Domain Number - Region: 190-245
Classification Level Classification E-value
Superfamily YheA/YmcA-like 0.0133
Family YmcA-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) gi|51892113|ref|YP_074804.1|
Sequence length 517
Comment hypothetical protein STH975 [Symbiobacterium thermophilum IAM 14863]
Sequence
MLIAAALIVAVAVLVVANLRNQPASGAATQGPKGAPEVRVQAVRRGSLRQEVIAPGVLEA
TGVHEVRAPFTTKAVTLKVGIGERVTAGQVLAVLDDADLALQVSAQEAQVARMESTLASL
RLQQQEAPLQLDQRLAQARAQLLQAEDQLASVMRQDDALRTRLEQARVNLTTLQNRSAEG
AERVAAARAALLEAEEAYKADPGNPALRAKYEQARSAYDEALRQSQQAAEQAAAQLRAAY
DELAAAEADYARVSGDNPVAVQLAASQVEAARIALQLAEMEAESGGALAEQVRAAEIELA
AARTSLAAMREKLAQAQLTAPVSGTVLAVAAQDGMPAQETQVLLTIGNLDVLKVKAQVDE
LDIGKVRPEQPLSVETNGTPGELFHGRVTRVAAQATAAGGSPFFVVEGEVANREGLLRAG
LNAEVTIATAERQDAIVVPAAAVRTRDGQPSVLVVDGFAVKVRPVRVGLRTETEVEILEG
LEEGERIVVSPFTLINSLQEGDPVRVEEVDENWGKSQ
Download sequence
Identical sequences Q67QT3
292459.STH975 gi|51892113|ref|YP_074804.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]