SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YDR418W from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YDR418W
Domain Number 1 Region: 1-86
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 3.73e-29
Family Ribosomal L11/L12e N-terminal domain 0.0000267
Further Details:      
 
Domain Number 2 Region: 75-147
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 8.05e-16
Family Ribosomal protein L11, C-terminal domain 0.0054
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Locus: YDR418W   Protein: S000002826
Sequence length 165
Comment RPL12B SGDID:S000002826, Chr IV from 1301609-1302106, Verified ORF, "Protein component of the large (60S) ribosomal subunit, nearly identical to Rpl12Ap; rpl12a rpl12b double mutant exhibits slow growth and slow translation; has similarity to E. coli L11 and rat L12 ribosomal proteins"
Sequence
MPPKFDPNEVKYLYLRAVGGEVGASAALAPKIGPLGLSPKKVGEDIAKATKEFKGIKVTV
QLKIQNRQAAASVVPSASSLVITALKEPPRDRKKDKNVKHSGNIQLDEIIEIARQMRDKS
FGRTLASVTKEILGTAQSVGCRVDFKNPHDIIEGINAGEIEIPEN
Download sequence
Identical sequences A0A0L8VS37 A0A250WJ43 A6ZQP7 B3LFN8 C7GSB2 C8Z5Y0 E7KBB4 E7KM58 E7LT68 E7NG89 E7Q2H1 E7QDE5 G2WCI0 H0GFB7 N1P771 P0CX53 P0CX54
NP_010706.3.97178 NP_010860.1.97178 YDR418W YEL054C YEL054C YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C YEL054C YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C 3j16_H 3j77_62 3j78_62 4v6i_BJ 4v7f_I 4v7r_DL 5dge_m2 5fl8_K 5jcs_K 5juo_P 5jup_P 5jus_P 5jut_P 5juu_P SCRT_00116 SCRT_04417 YDR418W YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C YT749 YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C tr|A6ZQP7|A6ZQP7_YEAS7 YDR418W YEL054C YDR418W YDR418W YEL054C YDR418W YEL054C YDR418W YEL054C ORFP:5290 ORFP:5934 4932.YDR418W 4932.YEL054C YDR418W YEL054C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]