SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YKL129C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YKL129C
Domain Number 1 Region: 26-759
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 1.76e-240
Family Motor proteins 0.000000000133
Further Details:      
 
Domain Number 2 Region: 1106-1183
Classification Level Classification E-value
Superfamily SH3-domain 0.0000000000000223
Family SH3-domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YKL129C   Protein: S000001612
Sequence length 1271
Comment MYO3 SGDID:S000001612, Chr XI from 200163-196348, reverse complement, Verified ORF, "One of two type I myosins; localizes to actin cortical patches; deletion of MYO3 has little effect on growth, but myo3 myo5 double deletion causes severe defects in growth and actin cytoskeleton organization"
Sequence
MAVIKKGARRKDVKEPKKRSAKIKKATFDANKKKEVGISDLTLLSKISDESINENLKKRF
KNGIIYTYIGHVLISVNPFRDLGIYTNAVLESYKGKNRLEVPPHVFAIAESMYYNLKSYN
ENQCVIISGESGAGKTEAAKRIMQYIAAASNSHSESIGKIKDMVLATNPLLESFGCAKTL
RNNNSSRHGKYLEIKFNSQFEPCAGNITNYLLEKQRVVGQIKNERNFHIFYQFTKGASDT
YKQMFGVQMPEQYIYTAAAGCTSADQLMRKDYEGTLEAMRTIGLVQEEQDQIFRMLAAIL
WIGNISFIENEEGNAQVGDTSVTDFVAYLLQVDASLLVKCLVERIMQTSHGMKRGSVYHV
PLNPVQATAVRDALAKAIYNNLFDWIVDRVNVSLQAFPGADKSIGILDIYGFEIFEHNSF
EQICINYVNEKLQQIFIQLTLKAEQETYEREKIKWTPIKYFDNKVVCDLIEAKNPPGILA
AMNDSIATAHADSNAADQAFAQRLNLFNSNPYFELRANKFVIKHYAGDVTYDINGITDKN
KDQLQKDLIELIGTTTNTFLSTIFPDDVDKDSKRRPPTAGDKIIKSANELVETLSKAEPS
YIRTIKPNQTKSPNDYDDHQVLHQVKYLGLQENVRIRRAGFAYRQTFEKFVERFYLLSPD
CSYAGDYTWDGDTLEAVKLILRDAMIPEKEFQLGVTSVFIKTPESLFALEDMRDKYWYNM
AARIQRAWRRFLQRRIDAAIKIQRTIREKKGGNKYVKLRDYGTKLLAGKKERRSMSLLGY
RAFMGDYLSCNESKTKGSYIRRQVGIKDKVVFSIKGECLHSKFGRSAQRLKKVFILTKKT
FYIIGQTREQNAMKYTQDYKIDVGKIKQVSLTNLQDDWMGVILVNSTQSDPLINTPFKTE
LMTRLKKLNEKIMIKVGPTIEYHKQPNKLHTVRSKISDSAPKYGDIYKSSTIYVRRGHPA
NSKSNKKPKNPGGLSGKPIKSKKSKHKSTHKHTHSHRSHRDAAKKQPLPSQKPVNPLSLR
ATAAQAAYNPKPDKTVPIKSSAIPAAKVSSKHSSKPSSKEKVAVKKASSSHKSSSAKQNQ
VSMPPSKGVEKNKEPLKETTATATANIPIPPPPPPMGQPKDPKFEAAYDFPGSGSSSELP
LKKGDIVFISRDEPSGWSLAKLLDGSKEGWVPTAYMTPYKDTRNTVPVAATGAVNDVTNQ
KSSQIDNTISSAQEGVQFGSATVGPTSDNQSNPVGTFSDGLASALAARANKMRAESADDD
DNDDGDDDDDW
Download sequence
Identical sequences 4932.YKL129C YKL129C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]