SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for YNL185C from Saccharomyces cerevisiae SGD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  YNL185C
Domain Number 1 Region: 9-73
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 9.94e-25
Family Ribosomal L11/L12e N-terminal domain 0.0002
Further Details:      
 
Domain Number 2 Region: 69-157
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.44e-16
Family Ribosomal protein L11, C-terminal domain 0.00094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Locus: YNL185C   Protein: S000005129
Sequence length 158
Comment MRPL19 SGDID:S000005129, Chr XIV from 292671-292195, reverse complement, Verified ORF, "Mitochondrial ribosomal protein of the large subunit"
Sequence
MSQAAKNVIVKLIVGAGQAAPSPPVGPALGSKGIKAIDFCKEFNARSANYQPGVPVPVLI
TIKPDRTFTFEMKSPPTGYLLLKALKMDKGHGQPNVGTMLGSAPAKGPTRALGELSLKHV
YEIAKIKKSDERHSLLEMEGIVKSIVGVAKSMGIKVVP
Download sequence
Identical sequences A0A250WH03 A6ZRQ2 B3LP34 B5VQM4 C7GTF7 C8ZG45 E7KGZ7 E7LZ95 E7NM75 E7QJS2 G2WLS5 H0GME5 N1NXR7 P53875
YNL185C YNL185C YNL184C YNL185C YNL185C SCRT_03315 YNL184C YNL185C 4932.YNL185C YNL185C YNL184C YNL185C YNL185C YNL185C tr|A6ZRQ2|A6ZRQ2_YEAS7 YNL185C YNL185C NP_014214.1.97178 YNL184C YNL185C YNL185C YNL184C YNL185C YNL185C YNL185C YNL185C YNL185C YNL185C YNL185C YNL185C YNL184C YNL185C

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]