SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000004566|e1ya0A1|109.4.1.47|A:1-111,A:143-349,A:351-407,A:409-440,A:447-497 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000004566|e1ya0A1|109.4.1.47|A:1-111,A:143-349,A:351-407,A:409-440,A:447-497
Domain Number 1 Region: 1-456
Classification Level Classification E-value
Superfamily TPR-like 2.81e-116
Family Tetratricopeptide repeat (TPR) 0.000000000000057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000004566|e1ya0A1|109.4.1.47|A:1-111,A:143-349,A:351-407,A:409-440,A:447-497
Sequence length 458
Sequence
MSLQSAQYLRQAEVLKADMTDSKLGPAEVWTSRQALQDLYQKMLVTDLEYALDKKVEQDL
WNHAFKNQITTLQGQAKNRANPNRSEVQANLSLFLEAASGFYTQLLQELCTQSSSCSYIC
QHCLVHLGDIARYRNQTSQAESYYRHAAQLVPSNGQPYNQLAILASSKGDHLTTIFYYCR
SIAVKFPFPAASTNLQKALSKALESRDEVKTKWGVSDFIKAFIKFHGHVYLSKSLEKLSP
LREKLEEQFKELLFQKAFNSQQLVHVTVINLFQLHHLRDFSNETEQHTYSQDEQLCWTQL
LALFMSFLGILCKCPLQNSQEESYNAYPLPAVKVSMDWLRLRPRVFQEAVVDERQYIWPW
LISLLNSFHPHEEDLSISATPLPEEFELQGFLALRPSFRNLDFSKGHKEGQQRRIRQQRL
ISIGKWIADNQPRLIQCENEVGKLLFITEIPELILEDP
Download sequence
Identical sequences 000004566|e1ya0A1|109.4.1.47|A:1-111,A:143-349,A:351-407,A:409-440,A:447-497

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]