SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000059819|e1wao31|109.4.1.88|3:1-153 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059819|e1wao31|109.4.1.88|3:1-153
Domain Number 1 Region: 4-133
Classification Level Classification E-value
Superfamily TPR-like 2.63e-33
Family Tetratricopeptide repeat (TPR) 0.000000312
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000059819|e1wao31|109.4.1.88|3:1-153
Sequence length 153
Sequence
galkraeelktqandyfkakdyenaikfysqaielnpsnaiyygnrslaylrtecygyal
gdatraieldkkyikgyyrraasnmalgkfraalrdyetvvkvkphdkdakmkyqecnki
vkqkaferaiagdehkrsvvdsldiesmtiede
Download sequence
Identical sequences 000059817|e1wao21|109.4.1.88|2:1-153 000059819|e1wao31|109.4.1.88|3:1-153 000059820|e1wao41|109.4.1.88|4:1-153 000059821|e1wao11|109.4.1.88|1:1-153 d1wao11 d1wao21 d1wao31 d1wao41

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]