SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000059827|e1fchB1|109.4.1.726|B:51-368 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059827|e1fchB1|109.4.1.726|B:51-368
Domain Number 1 Region: 2-316
Classification Level Classification E-value
Superfamily TPR-like 1.65e-119
Family Tetratricopeptide repeat (TPR) 0.00000000002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000059827|e1fchB1|109.4.1.726|B:51-368
Sequence length 318
Sequence
kgyqfeeenplrdhpqpfeeglrrlqegdlpnavllfeaavqqdpkhmeawqylgttqae
neqellaisalrrclelkpdnqtalmalavsftneslqrqaceilrdwlrytpayahlvt
paeegaggaglgpskrilgsllsdslflevkelflaavrldptsidpdvqcglgvlfnls
geydkavdcftaalsvrpndyllwnklgatlangnqseeavaayrralelqpgyirsryn
lgiscinlgahreavehflealnmqrksrgprgeggamseniwstlrlalsmlgqsdayg
aadardlstlltmfglpq
Download sequence
Identical sequences 000059827|e1fchB1|109.4.1.726|B:51-368 000059828|e2c0mC1|109.4.1.726|C:2-319 000059829|e2c0mF1|109.4.1.726|F:2-319 cath|current|1fchB00/285-602 d1fchb_ d2c0mc_ d2c0mf_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]