SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000059844|e1tjcB1|109.4.1.121|B:1-95 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059844|e1tjcB1|109.4.1.121|B:1-95
Domain Number 1 Region: 5-91
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000131
Family Tetratricopeptide repeat (TPR) 0.00000538
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000059844|e1tjcB1|109.4.1.121|B:1-95
Sequence length 95
Sequence
mfltaedsfelgkvayteadyyhtelwmeqalrqldegeistidkvsvldylsyavyqqg
dldkallltkklleldpehqrangnlkyfeyimak
Download sequence
Identical sequences 000004561|e1tjcA1|109.4.1.121|A:1-95 000059844|e1tjcB1|109.4.1.121|B:1-95 d1tjca_ d1tjcb_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]