SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000059848|e2c2lD1|109.4.1.665|D:1-201 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059848|e2c2lD1|109.4.1.665|D:1-201
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily TPR-like 1.8e-30
Family Tetratricopeptide repeat (TPR) 0.00000176
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000059848|e2c2lD1|109.4.1.665|D:1-201
Sequence length 201
Sequence
spsaqelkeqgnrlfvgrkypeaaacygraitrnplvavyytnralcylkmqqpeqalad
crraleldgqsvkahfflgqcqlemesydeaianlqrayslakeqrlnfgddipsalria
kkkrwnsieerrihqeselhsyltrliaaerereleecqrnhegheddghiraqqaciea
khdkymadmdelfsqvdekrk
Download sequence
Identical sequences 000004563|e2c2lA1|109.4.1.665|A:1-201 000059846|e2c2lC1|109.4.1.665|C:1-201 000059847|e2c2lB1|109.4.1.665|B:1-201 000059848|e2c2lD1|109.4.1.665|D:1-201 d2c2la1 d2c2lb1 d2c2lc1 d2c2ld1

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]