SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000059861|e2grlB2|109.4.1.219|B:71-286 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059861|e2grlB2|109.4.1.219|B:71-286
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily TPR-like 4.55e-83
Family PrgX C-terminal domain-like 0.00000000214
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000059861|e2grlB2|109.4.1.219|B:71-286
Sequence length 216
Sequence
SVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTF
NKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTI
QTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKN
IDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAK
Download sequence
Identical sequences 000059861|e2grlB2|109.4.1.219|B:71-286 000059873|e2aw6B2|109.4.1.219|B:71-286 000059879|e2grlD2|109.4.1.219|D:71-286

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]