SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000059875|e2axuB2|109.4.1.219|B:71-287 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000059875|e2axuB2|109.4.1.219|B:71-287
Domain Number 1 Region: 2-217
Classification Level Classification E-value
Superfamily TPR-like 1.52e-83
Family PrgX C-terminal domain-like 0.00000000204
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 000059875|e2axuB2|109.4.1.219|B:71-287
Sequence length 217
Sequence
SVNETGKEKLLISKIFTNPDLFDKNFQRIEPKRLTSLQYFSIYLGYISIAHHYNIEVPTF
NKTITSDLKHLYDKRTTFFGIDYEIVSNLLNVLPYEEVSSIIKPMYPIVDSFGKDYDLTI
QTVLKNALTISIMNRNLKEAQYYINQFEHLKTIKNISINGYYDLEINYLKQIYQFLTDKN
IDSYLNAVNIINIFKIIGKEDIHRSLVEELTKISAKE
Download sequence
Identical sequences 000059854|e2axzB2|109.4.1.219|B:71-287 000059857|e2axuK2|109.4.1.219|K:71-287 000059860|e2axuD2|109.4.1.219|D:71-287 000059862|e2grlC2|109.4.1.219|C:71-287 000059864|e2axzA2|109.4.1.219|A:71-287 000059866|e2axuG2|109.4.1.219|G:71-287 000059867|e2grlA2|109.4.1.219|A:71-287 000059869|e2aw6A2|109.4.1.219|A:71-287 000059870|e2axzD2|109.4.1.219|D:71-287 000059872|e2axuF2|109.4.1.219|F:71-287 000059874|e2axuC2|109.4.1.219|C:71-287 000059875|e2axuB2|109.4.1.219|B:71-287 000059878|e2axuJ2|109.4.1.219|J:71-287 000059881|e2axuA2|109.4.1.219|A:71-287 000059884|e2axuI2|109.4.1.219|I:71-287 000059885|e2axuL2|109.4.1.219|L:71-287 000059888|e2axuE2|109.4.1.219|E:71-287 000059890|e2axuH2|109.4.1.219|H:71-287

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]