SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000166380|e2vgxA1|109.4.1.731|A:6-139 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000166380|e2vgxA1|109.4.1.731|A:6-139
Domain Number 1 Region: 7-120
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000114
Family Tetratricopeptide repeat (TPR) 0.048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000166380|e2vgxA1|109.4.1.731|A:6-139
Sequence length 134
Sequence
GGGTIAMLNEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACR
QAMGQYDLAIHSYSYGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEF
KELSTRVSSMLEAI
Download sequence
Identical sequences 000166380|e2vgxA1|109.4.1.731|A:6-139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]