SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000224114|e1d2fA1|3016.1.1.19|A:287-390 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000224114|e1d2fA1|3016.1.1.19|A:287-390
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.12e-20
Family Cystathionine synthase-like 0.00000402
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000224114|e1d2fA1|3016.1.1.19|A:287-390
Sequence length 104
Sequence
WLDALRIYLKDNLTYIADKMNAAFPELNWQIPQSTYLAWLDLRPLNIDDNALQKALIEQE
KVAIMPGYTYGEEGRGFVRLNAGCPRSKLEKGVAGLINAIRAVR
Download sequence
Identical sequences 000224114|e1d2fA1|3016.1.1.19|A:287-390 001151716|e1d2fB2|3016.1.1.19|B:287-390

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]