SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000332502|e2vgyA1|109.4.1.731|A:14-145 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000332502|e2vgyA1|109.4.1.731|A:14-145
Domain Number 1 Region: 3-113
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000759
Family Tetratricopeptide repeat (TPR) 0.041
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000332502|e2vgyA1|109.4.1.731|A:14-145
Sequence length 132
Sequence
NEISSDTLEQLYSLAFNQYQSGKYEDAHKVFQALCVLDHYDSRFFLGLGACRQAMGQYDL
AIHSYEEGAVMDIKEPRFPFHAAECLLQKGELAEAESGLFLAQELIANKPEFKELSTRVS
SMLEAIKLKKEM
Download sequence
Identical sequences 000332502|e2vgyA1|109.4.1.731|A:14-145

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]