SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000366102|e3g1fG1|2002.1.1.140|G:9-225 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000366102|e3g1fG1|2002.1.1.140|G:9-225
Domain Number 1 Region: 2-216
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 2.73e-58
Family Decarboxylase 0.00000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000366102|e3g1fG1|2002.1.1.140|G:9-225
Sequence length 217
Sequence
mdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcrii
adfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltemsh
pgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqggd
pgetlrfadaiivgrsiyladnpaaaaagiiesikdl
Download sequence
Identical sequences 000366093|e3g1aB1|2002.1.1.140|B:9-225 000366095|e3g1dB1|2002.1.1.140|B:9-225 000366100|e3g1fE1|2002.1.1.140|E:9-225 000366101|e3g1fF1|2002.1.1.140|F:9-225 000366102|e3g1fG1|2002.1.1.140|G:9-225 000366108|e3g1fM1|2002.1.1.140|M:9-225 000366113|e3g1hE1|2002.1.1.140|E:9-225 000366114|e3g1hF1|2002.1.1.140|F:9-225 000366115|e3g1hG1|2002.1.1.140|G:9-225 000366121|e3g1hM1|2002.1.1.140|M:9-225 000393398|e3ltpB1|2002.1.1.140|B:9-225 001143489|e4o8rE1|2002.1.1.140|E:9-225 d3g1ab_ d3g1db_ d3g1fe_ d3g1ff_ d3g1fg_ d3g1fm_ d3g1he_ d3g1hf_ d3g1hg_ d3g1hm_ d3ltpb_ d4o8re_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]