SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 000393441|e3m43B1|2002.1.1.140|B:5-223 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000393441|e3m43B1|2002.1.1.140|B:5-223
Domain Number 1 Region: 5-218
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.41e-57
Family Decarboxylase 0.00000000618
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 000393441|e3m43B1|2002.1.1.140|B:5-223
Sequence length 219
Sequence
rvdvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfg
criiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevfllt
emshpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvga
qggdpgetlrfadaaivgrsiyladnpaaaaagiiesik
Download sequence
Identical sequences 000393441|e3m43B1|2002.1.1.140|B:5-223 d3m43b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]