SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 000997897|e4b94A1|109.4.1.436|A:1-141 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  000997897|e4b94A1|109.4.1.436|A:1-141
Domain Number 1 Region: 33-121
Classification Level Classification E-value
Superfamily TPR-like 0.00000142
Family Tetratricopeptide repeat (TPR) 0.03
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 000997897|e4b94A1|109.4.1.436|A:1-141
Sequence length 141
Sequence
GPGPEDWLSLLLKLEKNSVPLSDALLNKLIGRYSQAIEALPPDKYGQNESFARIQVRFAE
LKAIQEPDDARDYFQMARANCKKFAFVHISFAQFELSQGNVKKSKQLLQKAVERGAVPLE
MLEIALRNLNLQKKQLLSEEE
Download sequence
Identical sequences 000997897|e4b94A1|109.4.1.436|A:1-141 001015851|e4b94D1|109.4.1.436|D:1-141 cath|current|4b94A00/-2-199 cath|current|4b94D00/-2-199

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]