SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001108344|e4bt8A2|109.4.1.121|A:145-239 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001108344|e4bt8A2|109.4.1.121|A:145-239
Domain Number 1 Region: 3-90
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000000228
Family Tetratricopeptide repeat (TPR) 0.0000058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001108344|e4bt8A2|109.4.1.121|A:145-239
Sequence length 95
Sequence
FLTAEDCFELGKVAYTEADYYHTELWMEQALRQLDEGEISTIDKVSVLDYLSYAVYQQGD
LDKALLLTKKLLELDPEHQRANGNLKYFEYIMAKE
Download sequence
Identical sequences 001108344|e4bt8A2|109.4.1.121|A:145-239 001108346|e4bt8B2|109.4.1.121|B:145-239 001128036|e4bt9A2|109.4.1.121|A:145-239

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]