SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001140499|e4o11A1|2002.1.1.140|A:7-226 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001140499|e4o11A1|2002.1.1.140|A:7-226
Domain Number 1 Region: 3-218
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 1.13e-58
Family Decarboxylase 0.00000000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001140499|e4o11A1|2002.1.1.140|A:7-226
Sequence length 220
Sequence
dvmdvmnrlilamdlmnrddalrvtgevreyidtvkigyplvlsegmdiiaefrkrfgcr
iiadfkvadipetnekicratfkagadaiivhgfpgadsvraclnvaeemgrevflltem
shpgaemfiqgaadeiarmgvdlgvknyvgpstrperlsrlreiigqdsflispgvgaqg
gdpgetlrfadaiivgrsiyladnpaaaaagiiesikdll
Download sequence
Identical sequences 001125565|e4nx5A1|2002.1.1.140|A:7-226 001140499|e4o11A1|2002.1.1.140|A:7-226 001140500|e4o11B1|2002.1.1.140|B:7-226 d4nx5a_ d4o11a_ d4o11b_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]