SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001151920|e1o69B2|2111.77.1.31|B:12-244 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001151920|e1o69B2|2111.77.1.31|B:12-244
Domain Number 1 Region: 2-232
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.6e-70
Family GABA-aminotransferase-like 0.00000000203
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001151920|e1o69B2|2111.77.1.31|B:12-244
Sequence length 233
Sequence
GNELKYIEEVFKSNYIAPLGEFVNRFEQSVKDYSKSENALALNSATAALHLALRVAGVKQ
DDIVLASSFTFIASVAPICYLKAKPVFIDCDETYNIDVDLLKLAIKECEKKPKALILTHL
YGNAAKMDEIVEICKENDIVLIEDAAEALGSFYKNKALGTFGEFGVYSYNGNKIITTSGG
GMLIGKNKEKIEKARFYSTQARENCLHYEHLDYGYNYRLSNVLGAIGVAQMEV
Download sequence
Identical sequences 000224216|e1o69A2|2111.77.1.31|A:12-244 001151914|e1o61A2|2111.77.1.31|A:12-244 001151916|e1o62A2|2111.77.1.31|A:12-244 001151918|e1o62B2|2111.77.1.31|B:12-244 001151920|e1o69B2|2111.77.1.31|B:12-244 001151922|e1o61B2|2111.77.1.31|B:12-244

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]