SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001152283|e1gc3D3|2111.77.1.46|D:1-285 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001152283|e1gc3D3|2111.77.1.46|D:1-285
Domain Number 1 Region: 6-281
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.45e-91
Family AAT-like 0.000000000603
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001152283|e1gc3D3|2111.77.1.46|D:1-285
Sequence length 285
Sequence
MRGLSRRVQAMKPDAVVAVNAKALELRRQGVDLVALTAGEPDFDTPEHVKEAARRALAQG
KTKYAPPAGIPELREALAEKFRRENGLSVTPEETIVTVGGSQALFNLFQAILDPGDEVIV
LSPYWVSYPEMVRFAGGVVVEVETLPEEGFVPDPERVRRAITPRTKALVVNSPNNPTGAV
YPKEVLEALARLAVEHDFYLVSDEIYEHLLYEGEHFSPGRVAPEHTLTVNGAAKAFAMTG
WRIGYACGPKEVIKAMASVSRQSTTSPDTIAQWATLEALTNQEAS
Download sequence
Identical sequences 001152273|e1gc4A3|2111.77.1.46|A:1-285 001152275|e1gc4D3|2111.77.1.46|D:1-285 001152277|e1gc3B3|2111.77.1.46|B:1-285 001152279|e1gc3H3|2111.77.1.46|H:1-285 001152283|e1gc3D3|2111.77.1.46|D:1-285 001152285|e1gc3G3|2111.77.1.46|G:1-285 001152287|e1gc3E3|2111.77.1.46|E:1-285 001152295|e1gc3A3|2111.77.1.46|A:1-285 001152297|e1gc4C3|2111.77.1.46|C:1-285 001152299|e1gc3C3|2111.77.1.46|C:1-285 001152301|e1gc3F3|2111.77.1.46|F:1-285 001152307|e5bj4B3|2111.77.1.46|B:1-285 001152315|e5bj4A3|2111.77.1.46|A:1-285 001152331|e1gc4B3|2111.77.1.46|B:1-285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]