SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001152745|e1m4nA3|3016.1.1.63|A:315-433 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001152745|e1m4nA3|3016.1.1.63|A:315-433
Domain Number 1 Region: 1-114
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.97e-25
Family GABA-aminotransferase-like 0.00000114
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001152745|e1m4nA3|3016.1.1.63|A:315-433
Sequence length 119
Sequence
AMLSDKKLTKNYIAENHKRLKQRQKKLVSGLQKSGISCLNGNAGLFCWVDMRHLLRSNTF
EAEMELWKKIVYEVHLNISPGSSCHCTEPGWFRVCFANLPERTLDLAMQRLKAFVGEYY
Download sequence
Identical sequences 001152745|e1m4nA3|3016.1.1.63|A:315-433 001152747|e1ynuA3|3016.1.1.63|A:315-433

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]