SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001164477|e4ay6C7|109.4.1.217|C:4-221 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001164477|e4ay6C7|109.4.1.217|C:4-221
Domain Number 1 Region: 3-217
Classification Level Classification E-value
Superfamily TPR-like 7.59e-58
Family Tetratricopeptide repeat (TPR) 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001164477|e4ay6C7|109.4.1.217|C:4-221
Sequence length 218
Sequence
SCPTHADSLNNLANIKREQGNIEEAVRLYRKALEVFPEFAAAHSNLASVLQQQGKLQEAL
MHYKEAIRISPTFADAYSNMGNTLKEMQDVQGALQCYTRAIQINPAFADAHSNLASIHKD
SGNIPEAIASYRTALKLKPDFPDAYCNLAHCLQIVCDWTDYDERMKKLVSIVADQLEKNR
LPSVHPHHSMLYPLSHGFRKAIAERHGNLCLDKINVLH
Download sequence
Identical sequences 000185458|e3pe3A1|109.4.1.217|A:4-221 000410555|e3pe3B1|109.4.1.217|B:4-221 000410559|e3pe3C1|109.4.1.217|C:4-221 000410563|e3pe3D1|109.4.1.217|D:4-221 000864881|e4ay5A1|109.4.1.217|A:4-221 001164437|e4cdrA7|109.4.1.217|A:4-221 001164441|e4cdrB7|109.4.1.217|B:4-221 001164445|e4cdrC7|109.4.1.217|C:4-221 001164449|e4cdrD7|109.4.1.217|D:4-221 001164453|e4ay5C7|109.4.1.217|C:4-221 001164457|e4ay5B7|109.4.1.217|B:4-221 001164461|e4ay5D7|109.4.1.217|D:4-221 001164465|e4ay6A7|109.4.1.217|A:4-221 001164469|e4ay6B7|109.4.1.217|B:4-221 001164473|e4ay6D7|109.4.1.217|D:4-221 001164477|e4ay6C7|109.4.1.217|C:4-221 001674140|e4xi9A4|109.4.1.217|A:4-221 001674144|e4xi9B4|109.4.1.217|B:4-221 001674145|e4xi9C1|109.4.1.217|C:4-221 001674149|e4xi9D1|109.4.1.217|D:4-221 001674154|e4xifA2|109.4.1.217|A:4-221 001674158|e4xifB2|109.4.1.217|B:4-221 001674164|e4xifC4|109.4.1.217|C:4-221 001674165|e4xifD1|109.4.1.217|D:4-221

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]