SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001181313|e3hymF4|109.4.1.435|F:20-320 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001181313|e3hymF4|109.4.1.435|F:20-320
Domain Number 1 Region: 24-281
Classification Level Classification E-value
Superfamily TPR-like 2.2e-26
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001181313|e3hymF4|109.4.1.435|F:20-320
Sequence length 301
Sequence
ENLDVVVSLAERHYYNCDFKMCYKLTSVVMEKDPFHASCLPVHIGTLVELNKANELFYLS
HKLVDLYPSNPVSWFAVGCYYLMVGHKNEHARRYLSKATTLEKTYGPAWIAYGHSFAVES
EHDQAMAAYFTAAQLMKGCHLPMLYIGLEYGLTNNSKLAERFFSQALSIAPEDPFVMHEV
GVVAFQNGEWKTAEKWFLDALEKIKAIGNEVTVDKWEPLLNNLGHVCRKLKKYAEALDYH
RQALVLIPQNASTYSAIGYIHSLMGNFENAVDYFHTALGLRRDDTFSVTMLGHCIEMYIG
D
Download sequence
Identical sequences 001181313|e3hymF4|109.4.1.435|F:20-320 001181320|e3hymJ4|109.4.1.435|J:20-320 001181322|e3hymL4|109.4.1.435|L:20-320 001181329|e3hymD4|109.4.1.435|D:20-320

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]