SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001181684|e4i2wA4|109.4.1.114|A:5-131 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001181684|e4i2wA4|109.4.1.114|A:5-131
Domain Number 1 Region: 4-123
Classification Level Classification E-value
Superfamily TPR-like 1.54e-24
Family Tetratricopeptide repeat (TPR) 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001181684|e4i2wA4|109.4.1.114|A:5-131
Sequence length 127
Sequence
VQTAEEIRDEGNAAVKDQDYIKADELYTEALQLTTDEDKALRPVLYRNRAMARLKRDDFE
GAQSDCTKALEFDGADVKALFRRSLAREQLGNVGPAFQDAKEALRLSPNDKGIVEVLQRL
VKANNDK
Download sequence
Identical sequences 001181684|e4i2wA4|109.4.1.114|A:5-131 001303127|e4i2zA4|109.4.1.114|A:5-131

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]