SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001182409|e3iegB3|109.4.1.217|B:1-359 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001182409|e3iegB3|109.4.1.217|B:1-359
Domain Number 1 Region: 6-103
Classification Level Classification E-value
Superfamily Protein prenylyltransferase 2.6e-24
Family SCOPe 0.083
Further Details:      
 
Domain Number 2 Region: 121-245
Classification Level Classification E-value
Superfamily TPR-like 2.7e-19
Family Tetratricopeptide repeat (TPR) 0.055
Further Details:      
 
Domain Number 3 Region: 237-357
Classification Level Classification E-value
Superfamily TPR-like 7.47e-18
Family Tetratricopeptide repeat (TPR) 0.036
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001182409|e3iegB3|109.4.1.217|B:1-359
Sequence length 359
Sequence
advekhlelgkkllaagqladalsqfhaavdgdpdnyiayyrratvflamgkskaalpdl
tkvialkmdftaarlqrghlllkqgkldeaeddfkkvlksnpseqeekeaesqlvkadem
qrlrsqaldafdgadytaaitfldkilevcvwdaelrelraecfikegeprkaisdlkaa
sklksdnteafykistlyyqlgdhelslsevreclkldqdhkrcfahykqvkklnklies
aeelirdgrytdatskyesvmktepsvaeytvrskerichcfskdekpveairicsevlq
mepdnvnalkdraeaylieemydeaiqdyeaaqehnendqqireglekaqrllkqsqkr
Download sequence
Identical sequences 3ieg_A 3ieg_B 001148718|e3iegA3|109.4.1.217|A:1-359 001182409|e3iegB3|109.4.1.217|B:1-359

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]