SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001182504|e4ga2A2|109.4.1.726|A:7-150 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001182504|e4ga2A2|109.4.1.726|A:7-150
Domain Number 1 Region: 29-141
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000403
Family Tetratricopeptide repeat (TPR) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001182504|e4ga2A2|109.4.1.726|A:7-150
Sequence length 144
Sequence
RRSKADVERYIASVQGSTPSPRQKSIKGFYFAKLYYEAKEYDLAKKYICTYINVQERDPK
AHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGRAKYWVERA
AKLFPGSPAVYKLKEQLLDCEGED
Download sequence
Identical sequences 001182504|e4ga2A2|109.4.1.726|A:7-150

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]