SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001192643|e3e77A2|3016.1.1.108|A:271-377 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001192643|e3e77A2|3016.1.1.108|A:271-377
Domain Number 1 Region: 3-105
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.7e-22
Family GABA-aminotransferase-like 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001192643|e3e77A2|3016.1.1.108|A:271-377
Sequence length 107
Sequence
AAAMEKLSSIKSQTIYEIIDNSQGFYVCPVEPQNRSKMNIPFRIGNAKGDDALEKRFLDK
ALELNMLSLKGHRSVGGIRASLYNAVTIEDVQKLAAFMKKFLEMHQL
Download sequence
Identical sequences 001192643|e3e77A2|3016.1.1.108|A:271-377 001192754|e3e77B2|3016.1.1.108|B:271-377

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]