SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001192656|e2z9vA3|3016.1.1.24|A:269-392 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001192656|e2z9vA3|3016.1.1.24|A:269-392
Domain Number 1 Region: 1-95
Classification Level Classification E-value
Superfamily PLP-dependent transferases 4.96e-17
Family Cystathionine synthase-like 0.0067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001192656|e2z9vA3|3016.1.1.24|A:269-392
Sequence length 124
Sequence
EAVWARHALTAKAMRAGVTAMGLSVWAASDSIASPTTTAVRTPDGVDEKALRQAARARYG
VVFSSGRGETLGKLTRIGHMGPTAQPIYAIAALTALGGAMNAAGRKLAIGKGIEAALAVI
DADA
Download sequence
Identical sequences 001192654|e2z9uA3|3016.1.1.24|A:269-392 001192656|e2z9vA3|3016.1.1.24|A:269-392 001192658|e2z9xA3|3016.1.1.24|A:269-392 001192662|e2z9vB3|3016.1.1.24|B:269-392 001192664|e2z9wA3|3016.1.1.24|A:269-392 001192666|e2z9wB3|3016.1.1.24|B:269-392 001192747|e2z9uB3|3016.1.1.24|B:269-392 001192749|e2z9xB3|3016.1.1.24|B:269-392

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]