SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001192729|e3qm2B3|3016.1.1.108|B:287-386 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001192729|e3qm2B3|3016.1.1.108|B:287-386
Domain Number 1 Region: 2-100
Classification Level Classification E-value
Superfamily PLP-dependent transferases 2.41e-24
Family GABA-aminotransferase-like 0.00000435
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001192729|e3qm2B3|3016.1.1.108|B:287-386
Sequence length 100
Sequence
AAMHKINQQKAELLYGVIDNSDFYRNDVAQANRSRMNVPFQLADNTLDKVFLEESFAAGL
HALKGHRVVGGMRASIYNAMPIEGVKALTDFMIDFERRHG
Download sequence
Identical sequences 001192598|e3qm2A3|3016.1.1.108|A:287-386 001192729|e3qm2B3|3016.1.1.108|B:287-386

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]