SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001193341|e3dr4D3|3016.1.1.113|D:257-391 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001193341|e3dr4D3|3016.1.1.113|D:257-391
Domain Number 1 Region: 1-134
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.26e-25
Family GABA-aminotransferase-like 0.003
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001193341|e3dr4D3|3016.1.1.113|D:257-391
Sequence length 135
Sequence
AAIGLAQLERVDEHLAARERVVGWYEQKLARLGNRVTKPHVALTGRHVFWMYTVRLGEGL
STTRDQVIKDLDALGIESRPVFHPMHIMPPYAHLATDDLKIAEACGVDGLNLPTHAGLTE
ADIDRVIAALDQVLV
Download sequence
Identical sequences 001193333|e3dr4C3|3016.1.1.113|C:257-391 001193339|e3bn1A3|3016.1.1.113|A:239-373 001193341|e3dr4D3|3016.1.1.113|D:257-391 001193343|e3dr7D3|3016.1.1.113|D:257-391 001193353|e3bn1B3|3016.1.1.113|B:239-373 001193355|e3dr7A3|3016.1.1.113|A:257-391 001193357|e3dr7C3|3016.1.1.113|C:257-391 001193364|e3dr7B3|3016.1.1.113|B:257-391

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]