SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001193723|e3pdbC2|3016.1.1.190|C:301-401 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001193723|e3pdbC2|3016.1.1.190|C:301-401
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily PLP-dependent transferases 1.87e-24
Family AAT-like 0.00000425
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001193723|e3pdbC2|3016.1.1.190|C:301-401
Sequence length 101
Sequence
ILTSPDLRKQWLQEVKGMADRIISMRTQLVSNLKKEGSSHNWQHITDQIGMFCFTGLKPE
QVERLTKEFSVYMTKDGRISVAGVTSGNVGYLAHAIHQVTK
Download sequence
Identical sequences 001193721|e3pd6D2|3016.1.1.190|D:301-401 001193723|e3pdbC2|3016.1.1.190|C:301-401 001193731|e3hlmB2|3016.1.1.190|B:301-401 001193750|e3pd6A2|3016.1.1.190|A:301-401 001193753|e3hlmC2|3016.1.1.190|C:301-401 001193759|e3pdbB2|3016.1.1.190|B:301-401 001193767|e3hlmD2|3016.1.1.190|D:301-401 001193809|e3pd6C2|3016.1.1.190|C:301-401 001193811|e3pd6B2|3016.1.1.190|B:301-401 001193859|e3pdbD2|3016.1.1.190|D:301-401 001193956|e3pdbA2|3016.1.1.190|A:301-401 001392380|e3hlmA1|3016.1.1.190|A:301-401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]