SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001193890|e2zp7E2|2111.77.1.46|E:5-285 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001193890|e2zp7E2|2111.77.1.46|E:5-285
Domain Number 1 Region: 11-281
Classification Level Classification E-value
Superfamily PLP-dependent transferases 8.97e-73
Family AAT-like 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001193890|e2zp7E2|2111.77.1.46|E:5-285
Sequence length 281
Sequence
SWSEAFGKGAGRIQASTIRELLKLTQRPGILSFAGGLPAPELFPKEEAAEAAARILREKG
EVALQYSPTEGYAPLRAFVAEWIGVRPEEVLITTGSQQALDLVGKVFLDEGSPVLLEAPS
YMGAIQAFRLQGPRFLTVPAGEEGPDLDALEEVLKRERPRFLYLIPSFQNPTGGLTPLPA
RKRLLQMVMERGLVVVEDDAYRELYFGEARLPSLFELAREAGYPGVIYLGSFSKVLSPGL
RVAFAVAHPEALQKLVQAKQGADLHTPMLNQMLVHELLKEG
Download sequence
Identical sequences 001193682|e2zp7F2|2111.77.1.46|F:5-285 001193738|e2egyD2|2111.77.1.46|D:5-285 001193867|e3cbfA2|2111.77.1.46|A:5-285 001193869|e3cbfB2|2111.77.1.46|B:5-285 001193873|e2zp7A2|2111.77.1.46|A:5-285 001193875|e2zp7B2|2111.77.1.46|B:5-285 001193890|e2zp7E2|2111.77.1.46|E:5-285 001193917|e2zp7D2|2111.77.1.46|D:5-285 001193923|e2zp7C2|2111.77.1.46|C:5-285 001193954|e2egyA2|2111.77.1.46|A:5-285

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]