SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001386710|e4hw9A1|304.39.1.1|A:193-294 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001386710|e4hw9A1|304.39.1.1|A:193-294
Domain Number 1 Region: 4-101
Classification Level Classification E-value
Superfamily Mechanosensitive channel protein MscS (YggB), C-terminal domain 1.83e-27
Family Mechanosensitive channel protein MscS (YggB), C-terminal domain 0.00039
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001386710|e4hw9A1|304.39.1.1|A:193-294
Sequence length 102
Sequence
NTACRRIEWVCGVGYGSDIELVHKTIKDVIDTMEKIDKNMPTFIGITDFGSSSLNFTIRV
WAKIEDGIFNVRSELIERIKNALDANHIEIPFNKLDIAIKNQ
Download sequence
Identical sequences 001172545|e4hw9E9|304.39.1.1|E:193-294 001172551|e4hw9C9|304.39.1.1|C:193-294 001172557|e4hw9F9|304.39.1.1|F:193-294 001172563|e4hw9G9|304.39.1.1|G:193-294 001172569|e4hw9D9|304.39.1.1|D:193-294 001179290|e4hw9B6|304.39.1.1|B:193-294 001386710|e4hw9A1|304.39.1.1|A:193-294

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]