SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001558544|e4ynwB1|109.4.1.435|B:29-311 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001558544|e4ynwB1|109.4.1.435|B:29-311
Domain Number 1 Region: 5-76,103-141,175-278
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000276
Family Tetratricopeptide repeat (TPR) 0.029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001558544|e4ynwB1|109.4.1.435|B:29-311
Sequence length 283
Sequence
INPKELLDRATTLLEEGDIETAAKVARTAYEHIGENGRHAGAALTLLGQIHVELGDIDAA
RNYYAAAVKVDEDGSLPEELGGGPEKFLWLAQLSEEGGHDSVAWFERGATVLRAQIQSLM
DSLEQRPLSRGQVEAAIADKRRRLAETLCAVVEVYMTDLSWEDDAEQRCEALITEATMIA
PEWPETWQTVANVRISQERTEEAREALRRSLGLWTHLPPEDPGVPPFPSRVSLVRLLIEV
DMEEEALEVTERLIAEDDLSVEVWYLGGYARYRLGEKEREASG
Download sequence
Identical sequences 001554425|e4ynvA1|109.4.1.435|A:2-284 001556783|e4ynvB1|109.4.1.435|B:2-284 001557472|e4ynwA1|109.4.1.435|A:29-311 001558544|e4ynwB1|109.4.1.435|B:29-311

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]