SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001610272|e3cvqA1|109.4.1.435|A:7-321 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001610272|e3cvqA1|109.4.1.435|A:7-321
Domain Number 1 Region: 2-314
Classification Level Classification E-value
Superfamily TPR-like 1.86e-93
Family Tetratricopeptide repeat (TPR) 0.00000222
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001610272|e3cvqA1|109.4.1.435|A:7-321
Sequence length 315
Sequence
ntdypfeannpymyhenpmeeglsmlklanlaeaalafeavcqkepereeawrslgltqa
enekdglaiialnharaldpadiavhaalavshtnehnanaalaslrawllsqpqyeqlg
svnlqadvdiddlnvqsedfffaapneyrecrtllhaalemnpndaqlhaslgvlynlsn
nydsaaanlrravelrpddaqlwnklgatlangnrpqealdaynraldinpgyvrvmynm
avsysnmsqydlaakqlvraiymqvggttptgeasreatrsmwdffrmllnvmnrpdlve
ltyaqnvepfakefg
Download sequence
Identical sequences 001610272|e3cvqA1|109.4.1.435|A:7-321 d3cvqa_

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]