SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001694668|e4yd9c4|10.9.1.1|c:801-907 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001694668|e4yd9c4|10.9.1.1|c:801-907
Domain Number 1 Region: 2-106
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 1.16e-33
Family C-terminal domain of mollusc hemocyanin 0.00021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001694668|e4yd9c4|10.9.1.1|c:801-907
Sequence length 107
Sequence
ADRVFAGFLLHGIKISADVHLKICIEADCQEAGVIFVLGGETEMPWHFDRNYKMDITDVL
KKRNIPPEALFEHDSKIRLEVEIKSVDGAVLDPNSLPKPSLIYAPAK
Download sequence
Identical sequences 001694636|e4yd9E4|10.9.1.1|E:801-907 001694640|e4yd9H4|10.9.1.1|H:801-907 001694644|e4yd9K4|10.9.1.1|K:801-907 001694648|e4yd9N4|10.9.1.1|N:801-907 001694652|e4yd9Q4|10.9.1.1|Q:801-907 001694656|e4yd9T4|10.9.1.1|T:801-907 001694660|e4yd9W4|10.9.1.1|W:801-907 001694664|e4yd9Z4|10.9.1.1|Z:801-907 001694668|e4yd9c4|10.9.1.1|c:801-907 001697405|e4yd9B4|10.9.1.1|B:801-907

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]