SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001697384|e4yd9A7|10.9.1.1|A:1140-1242 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001697384|e4yd9A7|10.9.1.1|A:1140-1242
Domain Number 1 Region: 1-100
Classification Level Classification E-value
Superfamily C-terminal domain of mollusc hemocyanin 4.45e-26
Family C-terminal domain of mollusc hemocyanin 0.00064
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 001697384|e4yd9A7|10.9.1.1|A:1140-1242
Sequence length 103
Sequence
NRVAVTFMLEGLKKSLLVEYFIAADGTDQKMKAGEFYVLGSENEMPWKFDRPYKSDITYV
MDAMKLHYTDKYHVELRITDMTGAEVTDLKLVTSVIYEPGIGN
Download sequence
Identical sequences 001694584|e4yd9D8|10.9.1.1|D:1140-1242 001694592|e4yd9G8|10.9.1.1|G:1140-1242 001694600|e4yd9J8|10.9.1.1|J:1140-1242 001694608|e4yd9M8|10.9.1.1|M:1140-1242 001694616|e4yd9P8|10.9.1.1|P:1140-1242 001694624|e4yd9S8|10.9.1.1|S:1140-1242 001694632|e4yd9b8|10.9.1.1|b:1140-1242 001697384|e4yd9A7|10.9.1.1|A:1140-1242 001697391|e4yd9V6|10.9.1.1|V:1140-1242 001697398|e4yd9Y5|10.9.1.1|Y:1140-1242

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]