SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001713657|e5a31P1|109.4.1.717|P:297-466 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001713657|e5a31P1|109.4.1.717|P:297-466
Domain Number 1 Region: 29-164
Classification Level Classification E-value
Superfamily TPR-like 8.35e-30
Family Tetratricopeptide repeat (TPR) 0.008
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001713657|e5a31P1|109.4.1.717|P:297-466
Sequence length 170
Sequence
IENMDTFSNLLYVRSMKSELSYLAHNLCEIDKYRVETCCVIGNYYSLRSQHEKAALYFQR
ALKLNPRYLGAWTLMGHEYMEMKNTSAAIQAYRHAIEVNKRDYRAWYGLGQTYEILKMPF
YCLYYYRRAHQLRPNDSRMLVALGECYEKLNQLVEAKKCYWRAYAVGDVE
Download sequence
Identical sequences 001560854|e4ui9C2|109.4.1.717|C:291-460 001713654|e5a31C1|109.4.1.717|C:297-466 001713657|e5a31P1|109.4.1.717|P:297-466 001839134|e5g04P1|109.4.1.717|P:297-466 001839160|e5g05C3|109.4.1.717|C:297-466 001839161|e5g05P1|109.4.1.717|P:297-466 001871246|e5lcwC1|109.4.1.717|C:297-466 001871249|e5lcwP1|109.4.1.717|P:297-466

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]