SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001760242|e4cdrC1|2111.1.1.39|C:519-720 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001760242|e4cdrC1|2111.1.1.39|C:519-720
Domain Number 1 Region: 1-80
Classification Level Classification E-value
Superfamily TPR-like 0.0000000357
Family Tetratricopeptide repeat (TPR) 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001760242|e4cdrC1|2111.1.1.39|C:519-720
Sequence length 202
Sequence
LPEDAIVYCNFNQLYKIDPSTLQMWANILKRVPNSVLWLLRFPAVGEPNIQQYAQNMGLP
QNRIIFSPVAPKEEHVRRGQLADVCLDTPLCNGHTTGMDVLWAGTPMVTMPGETLASRVA
ASQLTCLGCLELIAKNRQEYEDIAVKLGTDLEYLKKVRGKVWKQRISSPLFNTKQYTMEL
ERLYLQMWEHYAAGNKPDHMIK
Download sequence
Identical sequences 000185461|e3pe3A4|2111.1.1.39|A:519-720 000410556|e3pe3B2|2111.1.1.39|B:519-720 000410560|e3pe3C2|2111.1.1.39|C:519-720 000410564|e3pe3D2|2111.1.1.39|D:519-720 000410568|e3pe4A2|2111.1.1.39|A:519-720 000410571|e3pe4C1|2111.1.1.39|C:519-720 000433170|e3taxA2|2111.1.1.39|A:519-720 000433174|e3taxC2|2111.1.1.39|C:519-720 000864882|e4ay5A2|2111.1.1.39|A:519-720 001181757|e4gyyC17|2111.1.1.39|C:519-720 001181781|e4gz3C17|2111.1.1.39|C:519-720 001181797|e4gywC17|2111.1.1.39|C:519-720 001674137|e4xi9A1|2111.1.1.39|A:519-720 001674141|e4xi9B1|2111.1.1.39|B:519-720 001674147|e4xi9C3|2111.1.1.39|C:519-720 001674152|e4xi9D4|2111.1.1.39|D:519-720 001674155|e4xifA3|2111.1.1.39|A:519-720 001674157|e4xifB1|2111.1.1.39|B:519-720 001674162|e4xifC2|2111.1.1.39|C:519-720 001674166|e4xifD2|2111.1.1.39|D:519-720 001759576|e4n3bA3|2111.1.1.39|A:519-720 001760106|e4ay5B2|2111.1.1.39|B:519-720 001760109|e4ay5C1|2111.1.1.39|C:519-720 001760116|e4ay5D4|2111.1.1.39|D:519-720 001760117|e4ay6A1|2111.1.1.39|A:519-720 001760122|e4ay6B2|2111.1.1.39|B:519-720 001760125|e4ay6C1|2111.1.1.39|C:519-720 001760130|e4ay6D2|2111.1.1.39|D:519-720 001760236|e4cdrA3|2111.1.1.39|A:519-720 001760238|e4cdrB1|2111.1.1.39|B:519-720 001760242|e4cdrC1|2111.1.1.39|C:519-720 001760246|e4cdrD1|2111.1.1.39|D:519-720 001760716|e4gywA1|2111.1.1.39|A:519-720 001760723|e4gyyA4|2111.1.1.39|A:519-720 001760725|e4gz3A2|2111.1.1.39|A:519-720 001760730|e4gz5A3|2111.1.1.39|A:519-720 001760733|e4gz5B2|2111.1.1.39|B:519-720 001760737|e4gz5C2|2111.1.1.39|C:519-720 001760742|e4gz5D3|2111.1.1.39|D:519-720 001760745|e4gz6A2|2111.1.1.39|A:519-720 001760749|e4gz6B2|2111.1.1.39|B:519-720 001760754|e4gz6C3|2111.1.1.39|C:519-720 001760758|e4gz6D3|2111.1.1.39|D:519-720 001761382|e4n39A4|2111.1.1.39|A:519-720 001761385|e4n3aA3|2111.1.1.39|A:519-720 001761390|e4n3cA4|2111.1.1.39|A:519-720 001763033|e5bnwA4|2111.1.1.39|A:519-720 001886037|e5hgvC4|2111.1.1.39|C:515-716 002092813|e5lvvA2|2111.1.1.39|A:540-741

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]