SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001869226|e5a7dE1|109.4.1.719|E:15-344 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001869226|e5a7dE1|109.4.1.719|E:15-344
Domain Number 1 Region: 158-329
Classification Level Classification E-value
Superfamily TPR-like 4.93e-28
Family Tetratricopeptide repeat (TPR) 0.013
Further Details:      
 
Domain Number 2 Region: 35-138
Classification Level Classification E-value
Superfamily TPR-like 4.22e-18
Family Tetratricopeptide repeat (TPR) 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 001869226|e5a7dE1|109.4.1.719|E:15-344
Sequence length 330
Sequence
GSSMCLELALEGERLCKAGDCRAGVAFFQAAIQAGTEDLRTLSAIYSQLGNAYFYLGDYN
KAMQYHKHDLTLAKSMNDRLGEAKSSGNLGNTLKVMGRFDEAAICCERHLTLARQLGDRL
SEGRALYNLGNVYHAKGKHLGQRNPGKFGDDVKEALTRAVEFYQENLKLMRDLGDRGAQG
RACGNLGNTYYLLGDFQAAIEHHQERLRIAREFGDRAAERRANSNLGNSHIFLGQFEDAA
EHYKRTLALAVELGEREVEAQSCYSLGNTYTLLHEFNTAIEYHNRHLAIAQELGDRIGEA
RACWSLGNAHSAIGGHERALKYAEQHLQLA
Download sequence
Identical sequences 001869223|e5a7dB1|109.4.1.719|B:15-344 001869226|e5a7dE1|109.4.1.719|E:15-344

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]