SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 001905802|e5lcwO1|109.4.1.452|O:206-755 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001905802|e5lcwO1|109.4.1.452|O:206-755
Domain Number 1 Region: 336-529
Classification Level Classification E-value
Superfamily TPR-like 0.000000000000656
Family Tetratricopeptide repeat (TPR) 0.032
Further Details:      
 
Domain Number 2 Region: 97-169,259-297
Classification Level Classification E-value
Superfamily TPR-like 0.00000759
Family Tetratricopeptide repeat (TPR) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001905802|e5lcwO1|109.4.1.452|O:206-755
Sequence length 550
Sequence
PLSQKQAEFFLSQQASLLKNDETKALTPASLQKELNNLLKFNPDFAEAHYLSYLNNLRVQ
DVFSSTHSLLHYFDRLILTGAESKSNGEEGYGRSLRYAALNLAALHCRFGHYQQAELALQ
EAIRIAQESNDHVCLQHCLSWLYVLGQKRSDSYVLLEHSVKKAVHFGLPYLASLGIQSLV
QQRAFAGKTANKLMDALKDSDLLHWKHSLSELIDISIAQKTAIWRLYGRSTMALQQAQML
LSMNSLEAVNAGVQQNNTESFAVALCHLAELHAEQGCFAAASEVLKHLKERFPPNSQHAQ
LWMLCDQKIQFDRAMNDGKYHLADSLVTGITALNSIEGVYRKAVVLQAQNQMSEAHKLLQ
KLLVHCQKLKNTEMVISVLLSVAELYWRSSSPTIALPMLLQALALSKEYRLQYLASETVL
NLAFAQLILGIPEQALSLLHMAIEPILADGAILDKGRAMFLVAKCQVASAASYDQPKKAE
ALEAAIENLNEAKNYFAKVDCKERIRDVVYFQARLYHTLGKTQERNRCAMLFRQLHQELP
SHGVPLINHL
Download sequence
Identical sequences 001673889|e4ui9O2|109.4.1.452|O:207-756 001716596|e5a31O1|109.4.1.452|O:206-755 001879639|e5g04O2|109.4.1.452|O:206-755 001879653|e5g05O1|109.4.1.452|O:206-755 001905802|e5lcwO1|109.4.1.452|O:206-755 001910417|e5l9tO1|109.4.1.452|O:206-755

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]