SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001945030|e4ehjB1|2111.29.1.1|B:2-169 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001945030|e4ehjB1|2111.29.1.1|B:2-169
Domain Number 1 Region: 2-167
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 9.19e-60
Family Phosphoglycerate kinase 0.00000386
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001945030|e4ehjB1|2111.29.1.1|B:2-169
Sequence length 168
Sequence
SFLTLKDVDLKDKKVLVRVDFNVPVKDGKVTSKVRIEAAIPTIQYILDQGGAVILMSHLG
RPTEGEYDSQFSLEPVAKALSEIINKPVKFAKDWLDGVDVKAGEIVMCENVRFNSGEKKS
TDDLSKKIASLGDVFVMDAFATAHRAQASTYGVAKYIPVACAGILLTN
Download sequence
Identical sequences 001945029|e4ehjA2|2111.29.1.1|A:2-169 001945030|e4ehjB1|2111.29.1.1|B:2-169

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]