SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for 001945128|e4o3fA1|2111.29.1.1|A:1-191 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  001945128|e4o3fA1|2111.29.1.1|A:1-191
Domain Number 1 Region: 5-191
Classification Level Classification E-value
Superfamily Phosphoglycerate kinase 3.65e-71
Family Phosphoglycerate kinase 0.0000000126
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) 001945128|e4o3fA1|2111.29.1.1|A:1-191
Sequence length 191
Sequence
MSLSNKLTLDKLDVKGKRVVMRVDFNVPMKNNQITNNQRIKAAVPSIKFCLDNGAKSVVL
MSHLGRPDGVPMPDKYSLEPVAAELKSLLGKDVLFLKDCVGPEVENACANPAAGTVILLE
NLRFHVEEEGKGKDASGNKVKAEPAKIDAFRASLSKLGDVYVNDAFGTAHRAHSSMVGVN
LPQKAGGFLMK
Download sequence
Identical sequences 001945128|e4o3fA1|2111.29.1.1|A:1-191

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]