SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 002045175|e5l0yH1|109.4.1.726|H:4-142 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002045175|e5l0yH1|109.4.1.726|H:4-142
Domain Number 1 Region: 7-131
Classification Level Classification E-value
Superfamily TPR-like 1.65e-21
Family Tetratricopeptide repeat (TPR) 0.0018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 002045175|e5l0yH1|109.4.1.726|H:4-142
Sequence length 139
Sequence
KRSANINKLRESGNAEYRKQRYGDAIKLYTLGLQMALTRPAWEPAGLVRDEIHQLYSNRA
QAYMQLGQWPEAAADAECSVEAKRQGNAKAWYRRGKCLMEMRRLQEAREWVARGLEFEGE
EKELAELLKEIDSKLAAEK
Download sequence
Identical sequences 002045175|e5l0yH1|109.4.1.726|H:4-142

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]