SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 002083041|e5nnrD1|109.4.1.799|D:11-580,D:645-749 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002083041|e5nnrD1|109.4.1.799|D:11-580,D:645-749
Domain Number 1 Region: 16-262
Classification Level Classification E-value
Superfamily TPR-like 2.37e-21
Family Tetratricopeptide repeat (TPR) 0.011
Further Details:      
 
Domain Number 2 Region: 372-526,588-641
Classification Level Classification E-value
Superfamily TPR-like 0.0000000000000327
Family Tetratricopeptide repeat (TPR) 0.0074
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) 002083041|e5nnrD1|109.4.1.799|D:11-580,D:645-749
Sequence length 675
Sequence
PLSTREANLFRTVIRHYEDKQYKRGLKAAEQILKKNPKHGDTMSMKALILNAQGKTEEAF
ALAKEALTIDMKSYICWHVYGILYRTNKNFDEAIKAYKFALKLEPESHQIQRDLAVLQIQ
MRDYAGYVQSRLNMLKARPQIRQNWTALAIAYHLEGNLEKAEHILTTYEKSLTTPPPKTD
LEHSEALLYKNTIIAERGDIERALQHLETDCKHCLDRLAVMELRASYLSKLARKDEAAKA
YRALLDRNPEHMDYYKGLISALDISADDEEAQKAVYDEYAAKYPRSDAAKRLPLNFLSGE
RFRTTAKAYLTLMFDKGVPSTFANLKHLYSDSFKKETLASLAEEYLNEYVNARPSDNQAD
GDGSKGKGAALYYLAQHYNYYMSRDLTRALEYVEKAIELDPKNVDFHMTKARIFKHQGDL
AKAAETMDYARSLDPKDRYINSKAAKYQLRNNENEKALATMGLFTRAETAGGPLADLTDM
QCIWFLTEDGEAWQRRGNTALALKRYHTVFSIFDTWQEDQFDFHSFSLRKGQIRAYVDMV
RWEDRLREHPFYFRAALDAVNLYLSMYDKPKDDDPNGEKLAATKDPLGDAMKFLNYILQF
SPKNIDGQIAGFEVYIRKKKYLLALRCLKAASAIDKNHPKVLEQAAKLRKIVSSALDSMA
PKLREVIQAELVGVP
Download sequence
Identical sequences 002083041|e5nnrD1|109.4.1.799|D:11-580,D:645-749

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]