SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for 002101178|e5mk3A1|109.4.1.14|A:1-361 from SCOP2 SCOPe CATH ECOD

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  002101178|e5mk3A1|109.4.1.14|A:1-361
Domain Number 1 Region: 1-361
Classification Level Classification E-value
Superfamily TPR-like 4.48e-180
Family SCOPe 0.0000000000572
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) 002101178|e5mk3A1|109.4.1.14|A:1-361
Sequence length 361
Sequence
MEAVPRMPMIWLDLKEAGDFHFQPAVKKFVLKNYGENPEAYNEELKKLELLRQNAVRVPR
DFEGCSVLRKYLGQLHYLQSRVPMGSGQEAAVPVTWTEIFSGKSVAHEDIKYEQACILYN
LGALHSMLGAMDKRVSEEGMKVSCTHFQCAAGAFAYLREHFPQAYSVDMSRQILTLNVNL
MLGQAQECLLEKSMLDNRKSFLVARISAQVVDYYKEACRALENPDTASLLGRIQKDWKKL
VQMKIYYFAAVAHLHMGKQAEEQQKFGERVAYFQSALDKLNEAIKLAKGQPDTVQDALRF
TMDVIGGKYNSAKKDNDFIYHEAVPALDTLQPVKGAPLVKPLPVNPTDPAVTGPDIFAKL
V
Download sequence
Identical sequences 5cru_A 5cru_B 5cru_C 5cru_D 5mjy_A 5mjy_B 5mjy_C 5mjy_D 5mjz_A 5mjz_B 5mk0_A 5mk0_C 5mk1_A 5mk1_B 5mk1_C 5mk1_D 5mk2_A 5mk2_B 5mk3_A 5mk3_B 5mk3_C 5mk3_D 002101165|e5mjyB1|109.4.1.14|B:1-361 002101168|e5mjzA1|109.4.1.14|A:1-361 002101170|e5mk0A1|109.4.1.14|A:1-361 002101174|e5mk1C1|109.4.1.14|C:1-361 002101176|e5mk2A1|109.4.1.14|A:1-361 002101177|e5mk2B1|109.4.1.14|B:1-361 002101178|e5mk3A1|109.4.1.14|A:1-361 002101179|e5mk3B1|109.4.1.14|B:1-361 002101180|e5mk3C1|109.4.1.14|C:1-361 002101181|e5mk3D1|109.4.1.14|D:1-361

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]